General Information

  • ID:  hor005283
  • Uniprot ID:  P06305
  • Protein name:  Pancreatic hormone
  • Gene name:  ppy
  • Organism:  Alligator mississippiensis (American alligator)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Alligator (genus), Alligatorinae (subfamily), Alligatoridae (family), Crocodylia (order), Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TPLQPKYPGDGAPVEDLIQFYDDLQQYLNVVTRPRF
  • Length:  36(1-36)
  • Propeptide:  TPLQPKYPGDGAPVEDLIQFYDDLQQYLNVVTRPRF
  • Signal peptide:  NA
  • Modification:  T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06305-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P06305-F1.pdbhor005283_AF2.pdbhor005283_ESM.pdb

Physical Information

Mass: 481919 Formula: C193H290N48O57
Absent amino acids: CHMSW Common amino acids: P
pI: 4.19 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -61.94 Boman Index: -6507
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.11
Instability Index: 6799.44 Extinction Coefficient cystines: 4470
Absorbance 280nm: 127.71

Literature

  • PubMed ID:  6745282
  • Title:  Conformational studies on the pancreatic polypeptide hormone family.
  • PubMed ID:  6146554
  • Title:   Isolation and characterization of reptilian insulin, glucagon, and pancreatic polypeptide: complete amino acid sequence of alligator (Alligator mississippiensis) insulin and pancreatic